DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and Ttpal

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_083788.2 Gene:Ttpal / 76080 MGIID:1923330 Length:343 Species:Mus musculus


Alignment Length:283 Identity:72/283 - (25%)
Similarity:132/283 - (46%) Gaps:29/283 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLDPKLAALAKSECNEEQAQRAEIIATIKTWITKS-PHLKAPTDEQLILAFLRRCRFSQEETKRR 70
            :|...|...|:.|..|:...|...:..::..:.|. |:|....|:..:|.|||..:|..:...:.
Mouse    35 SLTEDLVTKAREELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQL 99

  Fly    71 FDNYYSLRSVFPEVLGSRQ-------VDEALLTQL----QRGIHVIPMRPVSPEGPRVIISQFRN 124
            ..||:..|..:|||..:.:       ::...||.|    .||.||:.:||     .|.|.|.:  
Mouse   100 LVNYHGCRRSWPEVFSNLRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRP-----DRWIPSNY-- 157

  Fly   125 IDPKKSNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQ 189
              |...|    .:.:::.||.| ::.:...::|::.:.|.:.|::.:...:.||:.||...::..
Mouse   158 --PITEN----IRAVYLTLEKL-IQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIGILQD 215

  Fly   190 CIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKS-EDLYQHLPRDVMTIEYGGTNG 253
            ..|:|...:|::|..:..:.||..:..||..|:..:|.:|... ..|:.:|||:::..|||||.|
Mouse   216 GFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLPRNILPKEYGGTAG 280

  Fly   254 YQAEAVDHWRQKLLDSKDYLAKD 276
            ....|  .|...||.|::...|:
Mouse   281 ELDTA--SWNAVLLASEEDFVKE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 42/160 (26%)
TtpalNP_083788.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
CRAL_TRIO_N 57..103 CDD:215024 9/45 (20%)
SEC14 122..278 CDD:238099 42/169 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.