DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and SEC14L6

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_016884420.1 Gene:SEC14L6 / 730005 HGNCID:40047 Length:432 Species:Homo sapiens


Alignment Length:183 Identity:33/183 - (18%)
Similarity:65/183 - (35%) Gaps:44/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EGPRVIISQFRNIDPK----KSNPREAFKLIFIMLELLALECD---------------------- 151
            ||..|......::|||    .::.:|..:..|...|||..||:                      
Human    97 EGSPVWYHIVGSLDPKGLLLSASKQELLRDSFRSCELLLRECELQSQKPHWTRGTGISAPLDRRG 161

  Fly   152 --NAAI--------------SGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHM 200
              |.||              ..:|.:.....:.:..:.:....||::.|:.::...|.....:.:
Human   162 NCNTAIWPPMDRHKELGKRVEKIIAIFGLEGLGLRDLWKPGIELLQEFFSALEANYPEILKSLIV 226

  Fly   201 INMRKEGQTIFNFVTKFLPSKLPFKFVV--HKKSEDLYQHLPRDVMTIEYGGT 251
            :...|.....||.|..::..:...|.|:  ....::|.:.:..|.:.:|:|||
Human   227 VRAPKLFAVAFNLVKSYMSEETRRKVVILGDNWKQELTKFISPDQLPVEFGGT 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 31/181 (17%)
SEC14L6XP_016884420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.