DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and TTPA

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_000361.1 Gene:TTPA / 7274 HGNCID:12404 Length:278 Species:Homo sapiens


Alignment Length:269 Identity:70/269 - (26%)
Similarity:118/269 - (43%) Gaps:23/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFD 72
            |.|.||||.:      :|:.|.:           |....|..:..:|.|||...|..:...|...
Human    24 LQPGLAALRR------RAREAGV-----------PLAPLPLTDSFLLRFLRARDFDLDLAWRLLK 71

  Fly    73 NYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFK 137
            |||..|:..||:..... ..:::..|:.|.|.: :|...|.|.:|:|.:..:.|||.....:.|:
Human    72 NYYKWRAECPEISADLH-PRSIIGLLKAGYHGV-LRSRDPTGSKVLIYRIAHWDPKVFTAYDVFR 134

  Fly   138 LIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMIN 202
            :..|..||:..|.:... :|:..:.|..........|..|.:.||..|::....||:...||:||
Human   135 VSLITSELIVQEVETQR-NGIKAIFDLEGWQFSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLIN 198

  Fly   203 MRKEGQTIFNFVTKFLPSKLPFKFVVHKKS--EDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQK 265
            .......:|:.:..||..|:..:..:|..:  :.|.||.| |::.:||||......:....|...
Human   199 EPVIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFP-DILPLEYGGEEFSMEDICQEWTNF 262

  Fly   266 LLDSKDYLA 274
            ::.|:|||:
Human   263 IMKSEDYLS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 42/157 (27%)
TTPANP_000361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
CRAL_TRIO_N <40..73 CDD:215024 8/43 (19%)
CRAL_TRIO 99..248 CDD:395525 41/151 (27%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.