DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and Sec14l3

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_072130.1 Gene:Sec14l3 / 64543 RGDID:620812 Length:400 Species:Rattus norvegicus


Alignment Length:288 Identity:51/288 - (17%)
Similarity:98/288 - (34%) Gaps:81/288 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANTLRTLDPKLA-ALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQ 64
            |:..:..|.||.| .|||...|.:..               .|.|..| |:..:|.:||...|..
  Rat     1 MSGRVGDLSPKQAETLAKFRENVQDV---------------LPALPNP-DDYFLLRWLRARNFDL 49

  Fly    65 EETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRP-------------------- 109
            ::::.....|...|.       :..:|           |::..:|                    
  Rat    50 QKSEAMLRKYMEFRK-------TMDID-----------HILDWQPPEVIQKYMPGGLCGYDRDGC 96

  Fly   110 ------VSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLELLALECD------NAAISGLIWVV 162
                  :.|..|:.::......|..|:..|:..:::.        |||      ...|..::.:.
  Rat    97 PLWYDIIGPLDPKGLLFSVTKQDLLKTKMRDCERILH--------ECDLQTERLGRKIETIVMIF 153

  Fly   163 DARDVTMEQMMQYDPFLLKKAFALVDQCIP--LRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFK 225
            |...:.::...:....:.::.|.|:::..|  |:|:.|  :...|.....:|.:..||......|
  Rat   154 DCEGLGLKHFWKPLVEVYQEFFGLLEENYPETLKFMLI--VKATKLFPVGYNLMKPFLSEDTRRK 216

  Fly   226 FVVHKKS--EDLYQHLPRDVMTIEYGGT 251
            .||...|  |.|.:.:..:.:...:|||
  Rat   217 IVVLGNSWKEGLLKLISPEELPAHFGGT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 29/191 (15%)
Sec14l3NP_072130.1 CRAL_TRIO_N 13..59 CDD:215024 13/61 (21%)
SEC14 76..245 CDD:214706 30/179 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.