DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and SEC14L1

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001034662.3 Gene:SEC14L1 / 6397 HGNCID:10698 Length:719 Species:Homo sapiens


Alignment Length:309 Identity:55/309 - (17%)
Similarity:109/309 - (35%) Gaps:60/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLDPKL-AALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRR 70
            |.|.|| |...|....:....:...:..::.|:.::...|.|.||. ||.|||...|:.::.:..
Human   234 TPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEH-ILRFLRARDFNIDKAREI 297

  Fly    71 FDNYYSLRSVFPEVLGSRQVDEALLT----QLQRGIHVIPMRPVSPEGPRVIISQFRNIDPK--- 128
            .....:.|.       ..|||..|.|    |:.:..:.........:|..:.:.:...:|.|   
Human   298 MCQSLTWRK-------QHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLV 355

  Fly   129 KSNPREA-FKLIFIMLELLALECD------NAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFAL 186
            ::...|| .:.:..:.|.....|:      ...||....:||...:.|..:.:.....|.:...:
Human   356 RALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV 420

  Fly   187 VDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGT 251
            |:...|.....:.::...:....::..|:.|:......||::                   |.| 
Human   421 VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLI-------------------YAG- 465

  Fly   252 NGYQAEA--VDHWRQKLLDSKDYLAKDAQ-------------YGTNEKL 285
            |.||...  :|:..::::  .|:|:.:..             |.|.|:|
Human   466 NDYQGPGGLLDYIDKEII--PDFLSGECMCEVPEGGLVPKSLYRTAEEL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 22/169 (13%)
SEC14L1NP_001034662.3 PRELI 17..173 CDD:368069
CRAL_TRIO_N 256..301 CDD:215024 11/45 (24%)
CRAL_TRIO 326..490 CDD:366224 27/185 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.