DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and sec14l7

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_009303977.1 Gene:sec14l7 / 566865 ZFINID:ZDB-GENE-141216-145 Length:405 Species:Danio rerio


Alignment Length:272 Identity:56/272 - (20%)
Similarity:102/272 - (37%) Gaps:48/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANTLRTLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQE 65
            |:..:..|.||.|        |...|..|.:..:  |    ..|...||..| |.:||...|:..
Zfish    14 MSGRVGDLSPKQA--------EALTQFREKLEDV--W----DQLSNQTDHYL-LRWLRARTFNVP 63

  Fly    66 ETKR------RFDNYYSLRSVF-----PEVLGSRQVDEALLTQLQRG--IHVIPMRPVSPEGPRV 117
            :.:.      .|..:..|.::.     |||| .|.|...:....:.|  |....:.|:.|:|  :
Zfish    64 KAEAMLRKHLEFRRHMKLETIIDDWSPPEVL-ERYVAGGMCGYDREGSPIWFDIIGPLDPKG--L 125

  Fly   118 IISQFRNIDPKKSNPREAFKLIFIMLELLALECDNAA------ISGLIWVVDARDVTMEQMMQYD 176
            ::|..:. |..::..|:|        |||..||:..:      |..:..:.|...:.|:.:.:..
Zfish   126 LLSASKQ-DCLRTKIRDA--------ELLRRECEKQSKKLGKHIESITIIYDCEGLGMKHLWKPA 181

  Fly   177 PFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVV--HKKSEDLYQHL 239
            ..:..:...:.::..|....::.:|...|.....:|.|..||..:...|..|  ....:.|..::
Zfish   182 VEMYGEILTMYEENYPESLKKVLLIKAPKLFPIAYNLVKHFLREETRQKIAVLGSNWKDVLKNYV 246

  Fly   240 PRDVMTIEYGGT 251
            ..|.:...|||:
Zfish   247 DADQIPAAYGGS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 30/165 (18%)
sec14l7XP_009303977.1 CRAL_TRIO_N 26..72 CDD:215024 13/60 (22%)
CRAL_TRIO 97..258 CDD:279044 31/171 (18%)
GOLD_2 317..395 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.