powered by:
Protein Alignment CG10300 and AgaP_AGAP009378
DIOPT Version :9
| Sequence 1: | NP_651174.2 |
Gene: | CG10300 / 42798 |
FlyBaseID: | FBgn0039107 |
Length: | 311 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_001688263.1 |
Gene: | AgaP_AGAP009378 / 5668176 |
VectorBaseID: | AGAP009378 |
Length: | 147 |
Species: | Anopheles gambiae |
| Alignment Length: | 65 |
Identity: | 18/65 - (27%) |
| Similarity: | 30/65 - (46%) |
Gaps: | 4/65 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 DPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAP-TDEQLILAFLRRCRFSQEETKRRFD 72
|.:....|:.|.||....:|..:..::..:...|.|..| .||:.:|.|||...: :.:|.||
Mosquito 30 DQRWILKAEQELNETAENKARSLEQLRELLRDEPKLTVPLDDEKFLLKFLRPLGY---DVQRAFD 91
Fly 73 72
Mosquito 92 91
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG10300 | NP_651174.2 |
SEC14 |
95..251 |
CDD:238099 |
|
| AgaP_AGAP009378 | XP_001688263.1 |
CRAL_TRIO_N |
49..96 |
CDD:215024 |
13/46 (28%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1471 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.
