DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and clvs2

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001020716.1 Gene:clvs2 / 566769 ZFINID:ZDB-GENE-041014-313 Length:329 Species:Danio rerio


Alignment Length:267 Identity:58/267 - (21%)
Similarity:110/267 - (41%) Gaps:13/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLK-APTDEQLILAFLRRCRFSQEETKRRF 71
            |.|:....||.|..|......:.|..::..|...|.:. ..||:..||.|||..:|:..|..|..
Zfish     8 LSPETLEKAKVELKENPDTLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLL 72

  Fly    72 DNYYSLR----SVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNP 132
            ..|:..|    .:|..:   :..|..:...|:.|...: :..:...|.::::....|.|..:...
Zfish    73 AQYFEYRQQNLDMFKNL---KATDPGIKQALKDGFPGV-LSNLDRYGRKILVLFAANWDQSRYTF 133

  Fly   133 REAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVE 197
            .:..:.|.:.||.: :|.....::|.:.::|..:.|.:|..:..|.:|:.|...:....|.||..
Zfish   134 VDILRAILLSLEAM-IEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGG 197

  Fly   198 IHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKS-EDLYQHLPRDVMTIEYGGTNGYQAEAVDH 261
            ||.:|.......::..:..||..|...:..:|..: ..|:|.:..:::..|.||.  .....:..
Zfish   198 IHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLILPEILPSELGGM--LPPYDMGT 260

  Fly   262 WRQKLLD 268
            |.:.|||
Zfish   261 WARTLLD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 30/156 (19%)
clvs2NP_001020716.1 CRAL_TRIO_N 29..75 CDD:215024 13/45 (29%)
SEC14 106..251 CDD:238099 27/146 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579374
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.