DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and sec14l8

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001093463.1 Gene:sec14l8 / 558964 ZFINID:ZDB-GENE-060526-180 Length:395 Species:Danio rerio


Alignment Length:245 Identity:48/245 - (19%)
Similarity:90/245 - (36%) Gaps:31/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QRAEIIATIKTWITK-SPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRS--VFPEVLGS 87
            ::||.:|..:..:.. .|...:.:| ..:|.:||...|:.::::.....:...|.  ....:...
Zfish    11 KQAEALAQFREKVQDVLPQCPSQSD-HFLLRWLRARNFNLQKSEAMLRKHIEFRKHMKVDTITTE 74

  Fly    88 RQVDEALLTQLQRGI--HVIPMRPV-----SPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLEL 145
            .||.|.:...|..|:  |.....||     .|..|:.::......|..||..|:.        |:
Zfish    75 WQVPEVIDKYLSGGMCGHDREGSPVWYDVIGPLDPKGLMHSASKQDLIKSKVRDC--------EI 131

  Fly   146 LALECDNAA------ISGLIWVVDARDVTMEQMMQYDPFL--LKKAFALVDQCIPLRFVEIHMIN 202
            |..:||..:      |..:..|.|...:.|:.:  |.|.:  ..:...:.:...|.....:.:|.
Zfish   132 LQKDCDRQSERLGRNIESITMVYDCEGLGMKHL--YKPAIETYGEVLTMFEDNYPEGLKRLFVIK 194

  Fly   203 MRKEGQTIFNFVTKFLPSKLPFKFVV--HKKSEDLYQHLPRDVMTIEYGG 250
            ..|.....:|.|..||......|.:|  ....|.|.:::..:.:...|||
Zfish   195 APKLFPVAYNLVKHFLSEDTRRKVIVLGSNWQEVLQKYIDPEELPAYYGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 35/173 (20%)
sec14l8NP_001093463.1 CRAL_TRIO_N 13..59 CDD:215024 9/46 (20%)
SEC14 78..246 CDD:214706 36/177 (20%)
GOLD_2 304..382 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.