DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and Sec14l4

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001102560.1 Gene:Sec14l4 / 498399 RGDID:1565810 Length:412 Species:Rattus norvegicus


Alignment Length:255 Identity:51/255 - (20%)
Similarity:96/255 - (37%) Gaps:48/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QAQRA-----EIIATIKTWITKSPHLKAPTDEQLILAFLRRCRF---SQEETKRR---FDNYYSL 77
            |.|.|     ||:..:...:.|:       |:..:|.:||...|   ..|:..|:   |.|...|
  Rat    11 QQQEALTRFREILQDVLPTLPKA-------DDFFLLRWLRARNFDLKKSEDMLRKHVEFRNQQDL 68

  Fly    78 RSVF----PEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPK----KSNPRE 134
            ..:.    |||:  |..|...|.....            ||..|.......:|||    .::.::
  Rat    69 DHILTWQPPEVI--RLYDSGGLCGYDY------------EGCPVWFDLIGTLDPKGLFMSASKQD 119

  Fly   135 AFKLIFIMLELLALECD------NAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPL 193
            ..:....:.|:|..||:      ...:..::.|.|...:::..:.:....:.::.||:::...|.
  Rat   120 LIRKRIKVCEMLLHECELQSQKLGRKVERMVMVFDMEGLSLRHLWKPAVEVYQQFFAILEANYPE 184

  Fly   194 RFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVV--HKKSEDLYQHLPRDVMTIEYGGT 251
            ....:.:|...|.....||.|..|:......|.|:  ....::|.:.:..|.:.:|:|||
  Rat   185 TVKNLIVIRAPKLFPVAFNLVKSFIGEVTQKKIVILGGNWKQELLKFMSPDQLPVEFGGT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 28/167 (17%)
Sec14l4NP_001102560.1 CRAL_TRIO_N 13..59 CDD:215024 12/52 (23%)
SEC14 76..244 CDD:214706 33/181 (18%)
GOLD_2 284..379 CDD:404736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.