powered by:
Protein Alignment CG10300 and AgaP_AGAP009376
DIOPT Version :9
Sequence 1: | NP_651174.2 |
Gene: | CG10300 / 42798 |
FlyBaseID: | FBgn0039107 |
Length: | 311 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001230704.1 |
Gene: | AgaP_AGAP009376 / 4578436 |
VectorBaseID: | AGAP009376 |
Length: | 92 |
Species: | Anopheles gambiae |
Alignment Length: | 54 |
Identity: | 11/54 - (20%) |
Similarity: | 26/54 - (48%) |
Gaps: | 5/54 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 ALAKSECNEEQAQRAEII----ATIKTWITKSPHLKAPTD-EQLILAFLRRCRF 62
|.||.:...|..:..::: ..:::.:.:...|..|.| :..::.|||.|::
Mosquito 32 AKAKEKAARELRETPDVVEQSLQELRSLLQEEKTLYVPMDNDAFMIKFLRPCKY 85
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10300 | NP_651174.2 |
SEC14 |
95..251 |
CDD:238099 |
|
AgaP_AGAP009376 | XP_001230704.1 |
CRAL_TRIO_N |
50..92 |
CDD:215024 |
7/36 (19%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1471 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D559280at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.