DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP009376

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_001230704.1 Gene:AgaP_AGAP009376 / 4578436 VectorBaseID:AGAP009376 Length:92 Species:Anopheles gambiae


Alignment Length:54 Identity:11/54 - (20%)
Similarity:26/54 - (48%) Gaps:5/54 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALAKSECNEEQAQRAEII----ATIKTWITKSPHLKAPTD-EQLILAFLRRCRF 62
            |.||.:...|..:..:::    ..:::.:.:...|..|.| :..::.|||.|::
Mosquito    32 AKAKEKAARELRETPDVVEQSLQELRSLLQEEKTLYVPMDNDAFMIKFLRPCKY 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099
AgaP_AGAP009376XP_001230704.1 CRAL_TRIO_N 50..92 CDD:215024 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.