DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG33965

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster


Alignment Length:312 Identity:101/312 - (32%)
Similarity:164/312 - (52%) Gaps:4/312 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NTLRTLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEET 67
            |::|.|.|.|..:|..|.||..::....||.:|.|:.|.|||.|..::|.:|:|||..:||.|:.
  Fly     7 NSIRPLPPGLQKVAIEELNEVPSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKA 71

  Fly    68 KRRFDNYYSLRSVFPEVLG-SRQVDEALLTQLQRGIHVIPMRPVSPE--GPRVIISQFRNIDPKK 129
            |::.|.:|||::|.|||.. .|.||.|.:.::.| :.||...|:..|  ||.|.|.:..:.|..|
  Fly    72 KQKIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIR-LGVILRIPLDEEDTGPAVTIIRAGSYDINK 135

  Fly   130 SNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLR 194
            ...::..::..:..|::.||.|||::||.:.::|...||...:....|.||.|..|..|:.:|.|
  Fly   136 FKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEAMPTR 200

  Fly   195 FVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAV 259
            ...||.||:.|..:|.|..:..:.|.|:..:..|....|.:::.:|:..:..||||:.|...:..
  Fly   201 QKGIHFINVPKAFETGFKSLLGWFPGKIKERVSVSSDPEAIFERVPKHYLPEEYGGSKGTMKDIT 265

  Fly   260 DHWRQKLLDSKDYLAKDAQYGTNEKLRVGLASAWANGELDGMSGSFRKLELD 311
            |....||...:.|......:|.::|||...:....:....|:.||||:|.:|
  Fly   266 DQMEAKLCSYRSYFEDCQHFGAHDKLREEASVLNPDESHFGVDGSFRQLVID 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 45/157 (29%)
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 18/44 (41%)
SEC14 101..256 CDD:238099 44/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464528
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.