DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG33966

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster


Alignment Length:309 Identity:109/309 - (35%)
Similarity:167/309 - (54%) Gaps:4/309 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LRTLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKR 69
            :|.|.|:|...|....||...:..:.||.::.||.:.|||||.||:|.::.|||.|:||.|.||.
  Fly     4 IRPLSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTKS 68

  Fly    70 RFDNYYSLRSVFPEVLGSRQVD-EALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPR 133
            :.|.:|:||:.:||......|| :..|...:.|..||..||::..|||:.:.:....||.|...:
  Fly    69 KIDRFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMACYDPSKYTLQ 133

  Fly   134 EAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEI 198
            |..:...:|.:::..|.|.|.::|||.::|..:||....:|..|...||.....::.:|||...|
  Fly   134 EVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQGI 198

  Fly   199 HMINMRKEGQTIFNFVTKFLPSKLPFKFVVH-KKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHW 262
            |.||......||||.:...:..|...:..|| .|.|.||..:|:..:.:||||.||...|.:..|
  Fly   199 HFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGGENGSIPELLQQW 263

  Fly   263 RQKLLDSKDYLAKDAQYGTNEKLRVGLASAWANGELDGMSGSFRKLELD 311
            .|::|..::|..::..|||:|.||||....:.:  |.|:.||||:|.:|
  Fly   264 EQRILAYRNYWEEEKNYGTDESLRVGQPVDFES--LFGLQGSFRQLNVD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 49/156 (31%)
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 21/41 (51%)
SEC14 96..252 CDD:238099 48/155 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464522
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.