DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG33523

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:208 Identity:42/208 - (20%)
Similarity:81/208 - (38%) Gaps:39/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 RRFDNYYSL-----------RSVFPEVLGSRQVDEALLTQ--LQRGIHVIPMRPVSPEGPRVIIS 120
            :||...|.|           ..:..:..|:..:||:.|.|  |:.|...:....|  :|..::: 
  Fly    49 QRFLEMYDLDMETSFNSLWETCILRQSTGANDIDESELNQEYLKEGSVFVHNTDV--DGKPLLV- 110

  Fly   121 QFR-NIDPKKSNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAF 184
             || .:..|..|..|..:::...:|....|   ..::.|....|....::..|   |...:|:..
  Fly   111 -FRVKMHSKSKNLDELIRIVVYWVERTQRE---QHLTQLTIFFDMSGTSLASM---DLEFVKRIV 168

  Fly   185 ALVDQCIP--LRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFV-----VHKKSEDLYQHLPRD 242
            ....|..|  |.::.::.:..      :.|...|.:.:.||.|.|     :.||  |:.|::.:|
  Fly   169 ETFKQFYPNSLNYILVYELGW------VLNAAFKVIKAVLPPKAVEILKMISKK--DINQYINKD 225

  Fly   243 VMTIEYGGTNGYQ 255
            .....:||.:.|:
  Fly   226 NCLAIWGGEDNYE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 33/165 (20%)
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 30/157 (19%)
Motile_Sperm 293..396 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.