DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and Cralbp

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:320 Identity:84/320 - (26%)
Similarity:148/320 - (46%) Gaps:22/320 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLK-APTDEQLILAFLRRCRFSQEETKRRF 71
            |...|..:||.|..|::..|.:.:..::.|:.|:..|: ...|:..:|.|||..:||....::..
  Fly    11 LPEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTL 75

  Fly    72 DNYYSLRSVFPEVLGSRQVD--EALLTQL--QRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNP 132
            ..|.::|..||.:  |.|:|  |..|..|  |..|..:|.|  ...|.||::...:.::||....
  Fly    76 LKYLNIRRTFPHM--STQLDYLEPRLGDLIDQGYIFAVPQR--DKHGRRVVVINAKGLNPKIHTS 136

  Fly   133 REAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVE 197
            .:..|..|:..|.| :|.....|:||..|.|...||...:..::|....:.|...:|.:|:|..|
  Fly   137 CDQAKAHFLTYECL-MEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKE 200

  Fly   198 IHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHW 262
            ||:||:....:.:.:||...:.||:..:.:::...::|.:.:.:..:.:|.||....: |.::.|
  Fly   201 IHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKELMKSVDQGCLPLEMGGKVPMR-EMIELW 264

  Fly   263 RQKLLDSKD--------YLAKDAQYGTNEKLRVGLASAWAN---GELDGMSGSFRKLELD 311
            :|:|...:|        .|..|...........|.||....   .:::.:.|||||||.|
  Fly   265 KQELATKRDLILGLDKSILRSDRGIQRRSSFNAGKASTGGPNFVSQIESIEGSFRKLEFD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 40/157 (25%)
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 10/46 (22%)
SEC14 101..254 CDD:238099 39/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.