DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG32485

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster


Alignment Length:235 Identity:49/235 - (20%)
Similarity:77/235 - (32%) Gaps:59/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 APTDEQLILAFLRRCRFSQEETKRRFDNYYSLR-------------------SVFPEVLGSRQVD 91
            ||.:||.......|.:...|...:::.|.:|||                   :.:.|..|..::.
  Fly     7 APINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDAFQAILKTNKWRETYGVDKLS 71

  Fly    92 EALLTQLQ-------------RGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIML 143
            |...:||.             |.:..||.:..|.|         |:||       |..:.|...|
  Fly    72 EMDRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSE---------RDID-------ELTRFIVYNL 120

  Fly   144 ELLALECDNAAISGLIWVVDARDVTME----QMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMR 204
            |....:|.......|..|.|..:.:..    |::|...:||.|.|       |.|.....:||..
  Fly   121 EEACKKCFEEVTDRLCIVFDLAEFSTSCMDYQLVQNLIWLLGKHF-------PERLGVCLIINSP 178

  Fly   205 KEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVM 244
            ....||:..:...|......|........:|.|:|..|::
  Fly   179 GLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQYLIPDIL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 36/167 (22%)
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 34/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447117
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.