DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and Clvs2

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001101929.1 Gene:Clvs2 / 361459 RGDID:1306801 Length:236 Species:Rattus norvegicus


Alignment Length:180 Identity:39/180 - (21%)
Similarity:76/180 - (42%) Gaps:8/180 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLK-APTDEQLILAFLRRCRFSQEETKRRF 71
            |.|:....|:.|.||......:.|..::..:...|.:. ..||:..||.|||..:|...|..|..
  Rat     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLL 72

  Fly    72 DNYYSLRSVFPEVLGS-RQVDEALLTQLQRGIHVIP--MRPVSPEGPRVIISQFRNIDPKKSNPR 133
            ..|:..|....::..| :..|..:...|:.|   .|  :..:...|.::::....|.|..:....
  Rat    73 AQYFEYRQQNLDMFKSFKATDPGIKQALKDG---FPGGLANLDHYGRKILVLFAANWDQSRYTLV 134

  Fly   134 EAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKA 183
            :..:.|.:.||.: :|.....::|.:.::|..:.|.:|..:..|.:|:.|
  Rat   135 DILRAILLSLEAM-IEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLA 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 17/91 (19%)
Clvs2NP_001101929.1 CRAL_TRIO_N 29..75 CDD:215024 12/45 (27%)
SEC14 103..>204 CDD:301714 16/85 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.