DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG12926

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster


Alignment Length:311 Identity:116/311 - (37%)
Similarity:180/311 - (57%) Gaps:4/311 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANTLRTLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEE 66
            :|::|:|.|:||..|..|..|...:..|.|.|::|||:|.|||||..|.|.::||||.|::|.|:
  Fly     6 SNSIRSLSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEK 70

  Fly    67 TKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSN 131
            ||.:.||:|::|...||:..:|.|.|..|:.|..|..:...:|:..:|||:.||::...|.||.:
  Fly    71 TKLKLDNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYS 135

  Fly   132 PREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFV 196
            ..|..::..::.|:...|.|||.|||.:.::|.:.|....:.|:|..|:||...|.|:..|.|..
  Fly   136 IAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPK 200

  Fly   197 EIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDH 261
            ..|.:|.....:...:.....:..|:..:|.:|.|.:.||:::|::.:..||||:||...:.|..
  Fly   201 GFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSKLDSLYKYVPKECLPAEYGGSNGTIQDVVST 265

  Fly   262 WRQKLLDSKDYLAKDAQYGTNEKLRVGL-ASAWANGELDGMSGSFRKLELD 311
            ||.|||..|.:..::|.||||||||.|. .||   ..|.|:.||||||::|
  Fly   266 WRTKLLAYKPFFEEEASYGTNEKLRRGQPVSA---ESLFGIEGSFRKLDID 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 44/155 (28%)
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 23/44 (52%)
SEC14 117..254 CDD:238099 39/136 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464531
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.