DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG1902

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster


Alignment Length:315 Identity:92/315 - (29%)
Similarity:163/315 - (51%) Gaps:14/315 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LRTLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKR 69
            :|:|:|:||.:|:::..|:.:.....|..::|||.|..:|:|.||:|.::||||.||:..||.|:
  Fly     4 IRSLEPELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKK 68

  Fly    70 RFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPRE 134
            |...||:.:|...|:|..||||:.|:...:.||.....:|:.|.|||:..::..:|:|.|.:..:
  Fly    69 RVLFYYTYKSKERELLKGRQVDDKLIELARSGIFATLPKPIGPGGPRIHYTRMGHIEPSKHSVSD 133

  Fly   135 AFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIH 199
            .|:......|:.....||..|:|::.::|...:....::|:||.:.|:..|.::..||...|..|
  Fly   134 IFRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPANLVATH 198

  Fly   200 MINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQ 264
            ::|..:|.|.:...|...:..|....  :|.....|.:.:..:.:.:|.||.||..::|:..:..
  Fly   199 IVNASRETQFVLGLVRNVMKQKELLH--IHSTVASLRKAIGLEYLPVEMGGDNGSLSDAMTRYET 261

  Fly   265 KLLDSKDYLAKDAQYGTNEKLRVGLASAWANGELDGM--------SGSFRKLELD 311
            :||....|..:|.:||.:||||    .|....:..|.        .|:||.:..|
  Fly   262 QLLSFSPYFTEDERYGVDEKLR----EASEKDQERGAPLVTDVPNDGTFRMINFD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 35/155 (23%)
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 19/40 (48%)
CRAL_TRIO 100..248 CDD:279044 35/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464499
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.