DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG10026

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:272 Identity:61/272 - (22%)
Similarity:118/272 - (43%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLRTLDPKL-------------AALAKSECNEEQAQRAEIIATIKTWITK----SPHLKAPTDEQ 51
            |:.|::.||             .|..:.||   .:.:.::|...:.:|.:    .||   .:|.:
  Fly     9 TMPTIEHKLNITEEEVPEHIRRLAQEQGEC---PSSKDKVIEQFRNYILEHNECQPH---RSDAK 67

  Fly    52 LILAFLRRCRFSQEETKRRFDNYYSLR----SVFPEV--LGSRQVDEA-LLTQLQRGIHVIPMRP 109
            .:..|||...:..|.:.:...:||..|    |.:.:|  |..|.|.:: :||       |.|.| 
  Fly    68 YLEKFLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPLDLRHVGQSDILT-------VTPYR- 124

  Fly   110 VSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQ 174
             ...|.|::|.:|....|.:....:.|:...::.||.:||..:..:.| :.:.|.:|:.:|.::.
  Fly   125 -DQHGHRILIYRFGLWRPNQVTVDDIFRATIVLQELGSLEPISQIVGG-VGIFDLKDLGLEHILH 187

  Fly   175 YDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVH-KKSEDLYQH 238
            ..|.:.:|..||:...:|:|...:|::|........|.....||.:.:..|..:| .....|::|
  Fly   188 LSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKH 252

  Fly   239 LPRDVMTIEYGG 250
            :..:.:...|||
  Fly   253 INPEHLPKRYGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 37/157 (24%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 9/49 (18%)
SEC14 112..265 CDD:238099 38/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.