DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG10237

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:282 Identity:66/282 - (23%)
Similarity:115/282 - (40%) Gaps:35/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ECNEEQAQRAEIIATIKTWITKSPHLKAPTD-------EQLILAFLRRCRFSQEETKRRFDNYYS 76
            |..|.|.:.::.:|.:         |:|.||       |:.::.:||.|::..|..:.....||:
  Fly    62 ETPERQKEASKELARL---------LEAETDLLYPKGNEEWLIRYLRPCKYYPESARDLIKRYYA 117

  Fly    77 LR----SVFPEVLGSRQVD---EALLTQLQRGIHVIPMRPVSPEGPRVIISQF-RNIDPKKSNPR 133
            .:    .|:.::..|.:.:   ..:||       |.|.|  ...|.|:::.:. :....|:....
  Fly   118 FKVKHADVYTDLKPSNEANIFKHNILT-------VFPNR--DQLGRRILVLELGKRWKHKQVTLD 173

  Fly   134 EAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEI 198
            |.||...:.||...|| ....|.|.:.:.|...::::|..|:.|...|:....:...:|||...|
  Fly   174 EVFKGAVLFLEAAMLE-PETQICGAVVIFDMDGLSLQQTWQFTPPFAKRIVDWLQDSVPLRIKAI 237

  Fly   199 HMINMRKEGQTIFNFVTKFLPSKLPFKFVVH-KKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHW 262
            |::|..|..|.:|.....||..||..:.:.| ...|.|::::....:...|||.........|.|
  Fly   238 HIVNQPKIFQVVFALFKPFLKEKLRSRIIFHGTDRESLHKYMSPKCLPAAYGGFREASRIDSDQW 302

  Fly   263 RQKLLDSKDYLAKDAQYGTNEK 284
            .|.||...........||..:|
  Fly   303 YQLLLKCDTEFDTINSYGYKKK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 40/157 (25%)
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 10/55 (18%)
SEC14 137..290 CDD:238099 39/162 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447126
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.