DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG5973

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:287 Identity:63/287 - (21%)
Similarity:121/287 - (42%) Gaps:39/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLR-- 78
            |:.|..|....:.:.|..::..|....:|..|.|::.::.|||...:..|...:|..|:|.::  
  Fly    39 AQDELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLKNFYHMKLK 103

  Fly    79 ------SVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFK 137
                  ::.|..|  |.|.||.:      ::::|.|  ...|.|:::.:    ..||..|.:...
  Fly   104 YGAACENIIPSKL--RNVFEANI------LNLLPQR--DQHGRRLLVLE----AGKKWKPSQVPL 154

  Fly   138 L-IFIMLELLALEC---DNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEI 198
            : :|..::|..|..   ..:.|.|.:.::|...:.:..:.|:.|.........:.:||.:|...:
  Fly   155 VDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKAV 219

  Fly   199 HMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKS-EDLYQHLPRDVMTIEYGGTNGYQAEAVDHW 262
            |::|.......:|.....|:..||..:...|.|. :.|..|:....:..:|||:..::   :.| 
  Fly   220 HIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGSATWE---LPH- 280

  Fly   263 RQKLLD------SKDYLAKDAQYGTNE 283
             .|:|.      ||||...|: ||..|
  Fly   281 -GKVLGEFFECYSKDYELADS-YGYTE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 30/160 (19%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 10/44 (23%)
SEC14 116..272 CDD:238099 34/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.