DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and retm

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster


Alignment Length:295 Identity:57/295 - (19%)
Similarity:97/295 - (32%) Gaps:80/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RAEIIATIKTW-----ITKSPHLKAPTDEQ--------LILAFLRRCRFSQE----ETKRRFDNY 74
            |.|.|..::.|     .||||.|...:|:|        .|...|.:....||    |.::..|..
  Fly   171 REEGITHVERWTSPSDATKSPTLDQASDQQHSILLDGDFIARSLGQLSPMQESKLLELRKMLDGV 235

  Fly    75 YSLRSV--FPEVL------------------------GSRQVDEALLTQLQRGIHVIPMRP---- 109
            ..|..|  :..:|                        ...::| |||.:..:...|:...|    
  Fly   236 DDLERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWRREHRID-ALLAEYSKPAVVVEHFPGGWH 299

  Fly   110 -VSPEGPRVIISQFRNIDPK---KSNPREAFKLIFIMLELLALECDNAAISG------------L 158
             :..:|..|.|.:..::|.|   ||...:.       |..|||......|..            |
  Fly   300 HLDKDGRPVYILRLGHMDVKGLLKSLGMDG-------LLRLALHICEEGIQKINESAERLEKPVL 357

  Fly   159 IW--VVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSK 221
            .|  :||...::|..:.:.....|......|::..|.....:.::...:.....:..|:.|:...
  Fly   358 NWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEH 422

  Fly   222 LPFKFV------VHKKSEDLYQHLPRDVMTIEYGG 250
            ...||:      .|.| :.|.|:|..:::....||
  Fly   423 TRSKFLFYGPDCAHMK-DGLAQYLDEEIVPDFLGG 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 34/184 (18%)
retmNP_001260132.1 PRELI 17..173 CDD:282550 1/1 (100%)
CRAL_TRIO_N 222..268 CDD:215024 6/45 (13%)
CRAL_TRIO 293..456 CDD:279044 30/170 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.