DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP009311

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_559797.5 Gene:AgaP_AGAP009311 / 3291950 VectorBaseID:AGAP009311 Length:197 Species:Anopheles gambiae


Alignment Length:188 Identity:47/188 - (25%)
Similarity:83/188 - (44%) Gaps:15/188 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RTLDPKLAALAKSECNEEQAQRAEIIATIKTWITKS----PHLKAPTDEQLILAFLRRCRFSQEE 66
            |.|.||:|.:|::: .|:..:.:.:|..::..|.:.    ||   ..|:..::.|||...::...
Mosquito    15 RQLPPKVAEVARTQ-GEDPDRTSLMIEELRDMIYEKGECIPH---RIDDDYLVKFLRARFWNVHH 75

  Fly    67 TKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRG--IHVIPMRPVSPEGPRVIISQFRNIDPKK 129
            .......||:.|...||..  ..|:...|..|...  |.:.|.|  ..||.|||..:|....|.|
Mosquito    76 AYNLMVRYYAFRESNPEFY--ENVNPMALRSLGDDDIISISPYR--DQEGRRVICFKFGKWRPSK 136

  Fly   130 SNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALV 187
            ....:.|:...::||:.:||..:..:.| |.::|...:|:.......|.:.:|..||:
Mosquito   137 IPIVDLFRATMLLLEVGSLEPQSQVLGG-IGIMDLEGLTLNHAWNLTPAVAQKMLALL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 26/95 (27%)
AgaP_AGAP009311XP_559797.5 CRAL_TRIO_N 38..83 CDD:215024 8/47 (17%)
SEC14 105..>193 CDD:238099 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.