DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP005388

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_556028.1 Gene:AgaP_AGAP005388 / 3289958 VectorBaseID:AGAP005388 Length:330 Species:Anopheles gambiae


Alignment Length:323 Identity:79/323 - (24%)
Similarity:136/323 - (42%) Gaps:35/323 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHL-KAPTDEQLILAFLRRCRFSQEETKRR 70
            ||......:||.|..|:...|.:.:..::.||.|.|:: |..||...:|.|||..::|.......
Mosquito    25 TLPDLYRKMAKDELREDDEIREQSLTQMREWIAKHPYIRKCRTDASFLLRFLRFRKYSVPMACEA 89

  Fly    71 FDNYYSLRSVFPEVLGSRQVDEALLTQL-QRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPRE 134
            .:.|.::|..||........::..:.:| :.|  |........||..||:.:.:.::..|..|.|
Mosquito    90 LERYLAMRETFPTWFKKLDCNDPAMRELFEDG--VFTKLGQDSEGRMVILFRVKQLNVDKFGPLE 152

  Fly   135 AFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIH 199
            ..:|:.:::|.| ||.:...|.|...::|..|..|:....:....:|.....:::..|:||.||:
Mosquito   153 QGRLVALLIEAL-LEWEELQIGGFRVMLDFTDTVMKHYGMWGVSDMKIFMDAINRSYPIRFREIN 216

  Fly   200 MINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQ 264
            .....|...:|.|.:..|...||..:.|.|....::.......::...|||    :.:..:..|:
Mosquito   217 GAKFPKFAVSILNLLLTFASPKLKERIVCHNTVLEMKGKFEPSLLPHYYGG----ELDTEEMGRK 277

  Fly   265 KLLDSKD----YLAKD------AQYGTNEKLRVGLASAWANGEL------DGMSGSFRKLELD 311
            .|...:|    .||.|      |.|          :|.|:...|      .|::||||||.:|
Mosquito   278 FLKHLEDRRNVILALDDMDIDVAHY----------SSLWSQTNLVENEVEGGVAGSFRKLNVD 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 36/156 (23%)
AgaP_AGAP005388XP_556028.1 CRAL_TRIO_N 46..93 CDD:215024 12/46 (26%)
CRAL_TRIO 120..268 CDD:279044 36/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.