DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and Ptpmeg2

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster


Alignment Length:258 Identity:59/258 - (22%)
Similarity:97/258 - (37%) Gaps:62/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FSQEETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRG-IHVIPMRPVSPEGPRVIISQFRNI 125
            :.|.|..|..:..|   ::.|:|       |.|.::||.| ..::|.|..|  |..:.:......
  Fly   141 YEQHEQIRLKEYLY---NIDPDV-------EPLRSELQTGKFTILPARTSS--GAAIALFTANRH 193

  Fly   126 DPKKSNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQC 190
            .|...:.....:.|...|: .||:......:||:::.   |::..:...:|..|.:|...|:...
  Fly   194 SPLSVSHTTTLQGIVYQLD-SALQDSETQRAGLVFIY---DMSGSKYSNFDYDLSQKILTLLKGG 254

  Fly   191 IPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFK----FVVHKKSEDLYQ--------HLPRDV 243
            .|.|..::.:             ||..|..|.|||    ||..|..|.::.        |:||..
  Fly   255 YPARLKKVLI-------------VTAPLWFKAPFKILRLFVREKLRERVFTVSVPQLALHVPRKA 306

  Fly   244 MTIEYGGTNGYQAEAVDH--W----RQKLLDSKDYLAKDAQYGTNEKLRVGLASAWANGELDG 300
            :.|..|||     ..|||  |    ||.:.:.:|.|..:.         ||:.....:|...|
  Fly   307 LPIHLGGT-----LEVDHATWLLSCRQSMTNREDELLANI---------VGVGGGSGSGSAAG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 37/168 (22%)
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024 0/2 (0%)
SEC14 170..314 CDD:238099 35/162 (22%)
Y_phosphatase 557..803 CDD:278528
PTPc 559..803 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.