DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG31636

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster


Alignment Length:313 Identity:103/313 - (32%)
Similarity:160/313 - (51%) Gaps:5/313 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NTLRTLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEET 67
            :::|.|:..|..:...|.||..|:.|:.|..::.|:.|.|||:|.||:|.:|||||..:||.|..
  Fly     2 SSVRPLNAALQEICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERA 66

  Fly    68 KRRFDNYYSLRSVFPEVLGSRQV--DEALLTQLQRGIHV-IPMRPVSPEGPRVIISQFRNIDPKK 129
            |.:||.:|:|:...|||...|::  |..:|..::.|:.: |||....| ||||.|.:..:.|..|
  Fly    67 KEKFDRFYTLQRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDP-GPRVTIIRAGSYDTSK 130

  Fly   130 SNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLR 194
            ...::..::..:..|::..|.|||.:||.:.::|...||...:....|.||.|.....|:.:|.|
  Fly   131 HKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTR 195

  Fly   195 FVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAV 259
            ...||.||:....:|.||.:..|.|:|:..:..|......:|:.:.|..:..|||||.|...:..
  Fly   196 QKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSSDPAAIYELVRRKYLPQEYGGTGGNLQDIS 260

  Fly   260 DHWRQKLLDSKDYLAKDAQYGTNEKLR-VGLASAWANGELDGMSGSFRKLELD 311
            .....||.....|..:...:|.|:||| .|......:....|..|||||||:|
  Fly   261 HTMEAKLSSYGPYFRESQNFGANDKLREFGDHKRGNHRSSFGAVGSFRKLEID 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 46/156 (29%)
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 21/44 (48%)
SEC14 96..252 CDD:238099 46/156 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464519
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.