DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG3823

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:297 Identity:72/297 - (24%)
Similarity:129/297 - (43%) Gaps:9/297 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFP 82
            :|..|:|..... |:.::.|:...|.|.......|:..||...|......:|..:..|.||:...
  Fly     5 NEKAEDQLMTTR-ISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHA 68

  Fly    83 EVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLEL-L 146
            .:...|...:|...||.:...::|:..::||..:::..:..:.|..|.|...|.|:.|::.:. .
  Fly    69 HIFIDRDPLDASSQQLLQVADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIKVFFMVADCRF 133

  Fly   147 ALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIF 211
            |.|.:.....|.|.|.|....|:..:.:.....|:.....|.:..|:|..|||::|.......:.
  Fly   134 ATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKVM 198

  Fly   212 NFVTKFLPSKLPFKFV-VHKKSEDL-YQHLPRDVMTIEYGGTNGYQAEAVDHWRQKLLDSKDYLA 274
            ..|..|:..:: ||.: .|..:.|. |:|.||.::..||||..|..::....|.|.|.:.:|||.
  Fly   199 AVVKPFIKGEV-FKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQLLKEQRDYLM 262

  Fly   275 KDAQYGTNEKLRVGLASAWANGELDGMSGSFRKLELD 311
            ....:..|:..:.|...:..:|..:|:    |.||:|
  Fly   263 DTENWQINKIKKNGQRKSSDSGVTEGL----RSLEID 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 39/158 (25%)
CG3823NP_572313.1 SEC14 90..239 CDD:238099 37/149 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447102
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.