DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG3091

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster


Alignment Length:299 Identity:69/299 - (23%)
Similarity:130/299 - (43%) Gaps:26/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KSECNEEQAQRA----EIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSL 77
            |....|..|..|    :.:..:..|...:|:|....:..::|.||:...|..|.||...:..|.:
  Fly     8 KDSAPETSASPATGWSDKLTDLVAWFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCM 72

  Fly    78 RSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIM 142
            |:..|.:...|.:::.:..:..|...::.:..|:|:|.::|..:..::||:..|..|..| ||:|
  Fly    73 RNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGNKLIFFRMADLDPRTRNSVEETK-IFVM 136

  Fly   143 L---ELLALECDNAAISGLIWVVDARDV-------------TMEQMMQYDPFLLKKAFALVDQCI 191
            :   .....:.:....||..:|:|..|:             |:..:.....|:|:.....:.:..
  Fly   137 MSDARFTKPDVERETGSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAY 201

  Fly   192 PLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSED-LYQHLPRDVMTIEYGGTNGYQ 255
            |.|...:|:||.......:.:.::.||..::......|.:..| ||:.:|||::..||||..|..
  Fly   202 PSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLPNEYGGKAGTV 266

  Fly   256 AEAVDHWRQKLLDSKDYLAKDAQYGTNEKLRVGLASAWA 294
            ||......|.:.|:..||: |.:|.   |:.....|.|:
  Fly   267 AELKAKGIQSIRDNAAYLS-DERYW---KVAAQSKSRWS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 38/172 (22%)
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 37/161 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447084
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.