DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG3191

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster


Alignment Length:265 Identity:62/265 - (23%)
Similarity:121/265 - (45%) Gaps:11/265 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SECNEEQAQRAE-IIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQ-EETKRRFDNYYSLRSV 80
            |:.:|:..::.| .:..:..|..::..|....|..|:..|. :|.|.. |||::..:..|:||:.
  Fly    24 SDTSEQAVRKQERDLKELLEWFRQNDKLPKEIDPLLLRRFY-QCMFGDVEETRKLIEVNYALRNR 87

  Fly    81 FPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLEL 145
            .|.:...|...:|...:......::|:..::|:..:|.:..||..:..|.:..|..:..|::.:.
  Fly    88 HPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTEDTRAFFMVSDC 152

  Fly   146 LALECDNAA-----ISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRK 205
            ..:..|:.|     ..|.:.:.|.:..||..:.:.....|:.....:....|:|...|||||...
  Fly   153 RFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLAFPVRLRAIHMINCPT 217

  Fly   206 EGQTIFNFVTKFLPSKLPFKFV-VHKKS-EDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQKLLD 268
            ....|.:.|..|:..:: ||.: .|.:| ..||:.:||:::..||||..|.......|.::.|::
  Fly   218 YLDRIVSVVKPFISDEV-FKLIRFHTQSINTLYEFVPREMLPEEYGGGAGSLEALRTHTQKALVE 281

  Fly   269 SKDYL 273
            .:|||
  Fly   282 HRDYL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 36/162 (22%)
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 34/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447093
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.