DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and Ttpal

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001100007.1 Gene:Ttpal / 296349 RGDID:1305754 Length:343 Species:Rattus norvegicus


Alignment Length:283 Identity:73/283 - (25%)
Similarity:131/283 - (46%) Gaps:29/283 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLDPKLAALAKSECNEEQAQRAEIIATIKTWITKS-PHLKAPTDEQLILAFLRRCRFSQEETKRR 70
            :|...|...|:.|..|:...|...:..::..:.|. |:|....|:..:|.|||..:|..:...:.
  Rat    35 SLTEDLVTKAREELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQL 99

  Fly    71 FDNYYSLRSVFPEVLGSRQ-------VDEALLTQL----QRGIHVIPMRPVSPEGPRVIISQFRN 124
            ..||:..|..:|||..:.:       ::...||.|    .||.||:.:||     .|.|.|.:  
  Rat   100 LVNYHGCRRSWPEVFSNLRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRP-----DRWIPSNY-- 157

  Fly   125 IDPKKSNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQ 189
              |...|    .:.|::.||.| ::.:...::|::.:.|.:.|::.:...:.||:.:|...::..
  Rat   158 --PITEN----IRAIYLTLEKL-IQSEETQVNGVVILADYKGVSLSKASHFGPFIARKVIGILQD 215

  Fly   190 CIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKS-EDLYQHLPRDVMTIEYGGTNG 253
            ..|:|...:|::|..:..:.||..:..||..|:..:|.:|... ..|:..|||:::..|||||.|
  Rat   216 GFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLSSLHTSLPRNILPKEYGGTAG 280

  Fly   254 YQAEAVDHWRQKLLDSKDYLAKD 276
            ....|  .|...||.|:|...|:
  Rat   281 ELDTA--SWNAVLLASEDDFVKE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 42/160 (26%)
TtpalNP_001100007.1 CRAL_TRIO_N 57..103 CDD:215024 9/45 (20%)
SEC14 122..278 CDD:238099 42/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.