DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and Rlbp1

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001099744.1 Gene:Rlbp1 / 293049 RGDID:1309649 Length:317 Species:Rattus norvegicus


Alignment Length:255 Identity:65/255 - (25%)
Similarity:108/255 - (42%) Gaps:29/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQL---------------ILAFLRRCRFSQE 65
            ||.|.||.:..|.|.:..::..:    ..:|.:.|:|               :|.|:|..:|...
  Rat    48 AKDELNEREETRDEAVRELQELV----QAQAASGEELAVAVAERVQARDSAFLLRFIRARKFDVG 108

  Fly    66 ETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGI-HVIPMRPVSPEGPRVIISQFRNIDPKK 129
            ........|.:.|..:||:..|..: |||...::.|. .|:..|  ...|..|::....|...::
  Rat   109 RAYELLKGYVNFRLQYPELFDSLSM-EALRCTIEAGYPGVLSSR--DKYGRVVMLFNIENWHCEE 170

  Fly   130 SNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLR 194
            ....|..:....:||.| ||.:...|:|...|.:.:..||:|.....|..|||...::....|.|
  Rat   171 VTFDEILQAYCFILEKL-LENEETQINGFCIVENFKGFTMQQAAGLRPSDLKKMVDMLQDSFPAR 234

  Fly   195 FVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDL---YQHLPRDVMTIEYGGT 251
            |..||.|:......|.:|.|..||.:||..:..||  .:||   :|.:..:::..::|||
  Rat   235 FKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVH--GDDLDGFFQEIDENILPADFGGT 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 41/159 (26%)
Rlbp1NP_001099744.1 CRAL_TRIO_N 60..117 CDD:215024 8/60 (13%)
CRAL_TRIO 143..292 CDD:279044 41/153 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339625
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.