DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and Sec14l5

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001129182.2 Gene:Sec14l5 / 287060 RGDID:1564638 Length:696 Species:Rattus norvegicus


Alignment Length:254 Identity:48/254 - (18%)
Similarity:91/254 - (35%) Gaps:57/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLGSRQVDEALL 95
            :..::.|:.::...|.|.||. ||.|||...|..::.:.......|.|.       ..|||..|.
  Rat   246 LVQLRRWLQETHKGKIPKDEH-ILRFLRARDFHLDKARDMLCQSLSWRK-------QHQVDLLLQ 302

  Fly    96 TQLQRGIHVIPMRPVSP--------------EGPRVIISQFRNIDPK---KSNPREAFKLIFIML 143
            |          .||.:|              :|..:.|.:...:|.|   |:...||     ::.
  Rat   303 T----------WRPPAPLQEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEEA-----LLQ 352

  Fly   144 ELLAL------ECD------NAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFV 196
            .:|::      .|:      ...||....::|...:.|..:.:.....|.:...:|:...|....
  Rat   353 HVLSVNEEGQKRCEGNTRQFGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLG 417

  Fly   197 EIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSE-----DLYQHLPRDVMTIEYGG 250
            .:.::...:....::..|:.|:......||:::..|.     .|..:|.:||:....||
  Rat   418 RLLIVRAPRVFPVLWTLVSPFINENTRRKFLIYSGSNYQGPGGLVDYLDKDVIPDFLGG 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 31/190 (16%)
Sec14l5NP_001129182.2 PRELI 17..173 CDD:309720
Amidase <179..309 CDD:327489 20/80 (25%)
CRAL_TRIO_N 243..288 CDD:215024 11/42 (26%)
CRAL_TRIO 314..477 CDD:306996 27/168 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.