DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and Ttpa

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_037180.1 Gene:Ttpa / 25571 RGDID:3915 Length:278 Species:Rattus norvegicus


Alignment Length:269 Identity:72/269 - (26%)
Similarity:116/269 - (43%) Gaps:23/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFD 72
            :.|.||.|.:      :||...:           |....|..:..:|.|||...|..:...|...
  Rat    24 VQPGLAELRR------RAQEEGV-----------PETPQPLTDAFLLRFLRARDFDLDLAWRLMK 71

  Fly    73 NYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFK 137
            |||..|:..|| |.:.....::|..|:.|.|.: :|...|.|.||:|.:....|||.....:.|:
  Rat    72 NYYKWRAECPE-LSADLHPRSILGLLKAGYHGV-LRSRDPTGSRVLIYRISYWDPKVFTAYDVFR 134

  Fly   138 LIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMIN 202
            :..|..||:..|.:... :|:..:.|.....:....|..|.:.||..|:|....||:...||:||
  Rat   135 VSLITSELIVQEVETQR-NGVKAIFDLEGWQISHAFQITPSVAKKIAAVVTDSFPLKVRGIHLIN 198

  Fly   203 MRKEGQTIFNFVTKFLPSKLPFKFVVHKKS--EDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQK 265
            .......:|:.:..||..|:..:..:|..:  ..|.||.| |::.:||||......:....|...
  Rat   199 EPVIFHAVFSMIKPFLTEKIKGRIHLHGNNYKSSLLQHFP-DILPLEYGGNESSMEDICQEWTNF 262

  Fly   266 LLDSKDYLA 274
            ::.|:|||:
  Rat   263 IMKSEDYLS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 45/157 (29%)
TtpaNP_037180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CRAL_TRIO_N 25..73 CDD:215024 14/64 (22%)
CRAL_TRIO 99..248 CDD:395525 43/151 (28%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.