DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and spo20

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_593003.1 Gene:spo20 / 2543628 PomBaseID:SPAC3H8.10 Length:286 Species:Schizosaccharomyces pombe


Alignment Length:250 Identity:55/250 - (22%)
Similarity:96/250 - (38%) Gaps:51/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSP- 112
            |:..:|.|||..:|:.:::...|......|..|       .||:     |.:..|......||. 
pombe    49 DDATLLRFLRARKFNLQQSLEMFIKCEKWRKEF-------GVDD-----LIKNFHYDEKEAVSKY 101

  Fly   113 ----------EGPRVIISQFRNIDPKK----SNPREAFKLIFIMLELLALE----CDNAAISGLI 159
                      :|..|.:.|..|||.||    :.|....:.:....|:|||:    |...| .|||
pombe   102 YPQFYHKTDIDGRPVYVEQLGNIDLKKLYQITTPERMMQNLVYEYEMLALKRFPACSRKA-GGLI 165

  Fly   160 ----WVVDARDV---TMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKF 217
                .::|.:.|   ::..:..|    :::|.::.....|.|..:.::||......:.||.:..|
pombe   166 ETSCTIMDLKGVGITSIHSVYSY----IRQASSISQDYYPERMGKFYVINAPWGFSSAFNLIKGF 226

  Fly   218 LPSKLPFKFVV---HKKSEDLYQHLPRDVMTIEYGGT----NGYQAEAVDHWRQK 265
            |......|..:   :.||. |.:.:|.|.:..:.||.    .|.:......|.::
pombe   227 LDEATVKKIHILGSNYKSA-LLEQIPADNLPAKLGGNCQCPGGCELSDAGPWHEE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 41/184 (22%)
spo20NP_593003.1 CRAL_TRIO_N 29..74 CDD:215024 7/24 (29%)
SEC14 94..264 CDD:214706 40/175 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.