DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CG30339

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:316 Identity:112/316 - (35%)
Similarity:182/316 - (57%) Gaps:13/316 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANTLRTLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQE 65
            ||| ||.|..:|..:|::|.||.:.:....:..::.|:.|.|||:|..|:|.::.|||.|:||.|
  Fly     1 MAN-LRPLSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLE 64

  Fly    66 ETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKS 130
            :||.:.|::|:::::.||:.|.|.|||..|...:.|.:|...:|...:|||:.::.:...|||:.
  Fly    65 KTKSKLDHFYTIKTLMPELFGKRLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKEF 129

  Fly   131 NPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRF 195
            ...:.|:...::.|....|.|::.|||.:.:||...:::..:.|.|..|:|:.....::..|.|.
  Fly   130 KLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTRL 194

  Fly   196 VEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNG----YQA 256
            ..:|:||..|||..:.|.....:||||..:|.|:|..|.|.:.:||:.:..||||.||    .||
  Fly   195 KGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVYKNLEQLNEVIPREYLPEEYGGNNGRIADIQA 259

  Fly   257 EAVDHWRQKLLDSKDYLAKDAQYGTNEKLRVGLASAWANGE-LDGMSGSFRKLELD 311
            ||    .:|||..:.|.|:|:|||.:|:||.|..   .|.: :.|..||||||::|
  Fly   260 EA----EKKLLSYESYFAEDSQYGVDEQLRPGKR---VNADSIFGAEGSFRKLDID 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 46/155 (30%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 17/41 (41%)
CRAL_TRIO 109..250 CDD:279044 42/140 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464516
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.