Sequence 1: | NP_651174.2 | Gene: | CG10300 / 42798 | FlyBaseID: | FBgn0039107 | Length: | 311 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_505746.2 | Gene: | F28H7.8 / 185099 | WormBaseID: | WBGene00009241 | Length: | 410 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 41/201 - (20%) |
---|---|---|---|
Similarity: | 74/201 - (36%) | Gaps: | 69/201 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 PVSPEGPR--------VIISQFRNID----PKKSNPREAFKLIF-----IMLELLALECDNAAIS 156
Fly 157 GLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFL--- 218
Fly 219 -PSKL--------PFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQKLLDSKDYLA 274
Fly 275 KDAQYG 280 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10300 | NP_651174.2 | SEC14 | 95..251 | CDD:238099 | 32/170 (19%) |
F28H7.8 | NP_505746.2 | CRAL_TRIO_N | 16..61 | CDD:215024 | |
SEC14 | 93..251 | CDD:214706 | 40/198 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1471 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |