DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and F28H7.8

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_505746.2 Gene:F28H7.8 / 185099 WormBaseID:WBGene00009241 Length:410 Species:Caenorhabditis elegans


Alignment Length:201 Identity:41/201 - (20%)
Similarity:74/201 - (36%) Gaps:69/201 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PVSPEGPR--------VIISQFRNID----PKKSNPREAFKLIF-----IMLELLALECDNAAIS 156
            |:...||:        |::.:...||    .|...|.|....:|     |...|:.:|.:.....
 Worm    90 PIDIIGPQRKEDGDRLVVVDRAGRIDVSGLMKSVQPTEYLHEMFRSFEEIQRRLMKMEAETGVQC 154

  Fly   157 GLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFL--- 218
            .:.::.|.      :.:.:||.||    .:|:.  |.|      ::.:..||....|:.||:   
 Worm   155 YMHYIFDL------EALNFDPTLL----GVVNG--PFR------VSWQLVGQHYREFIDKFIVIN 201

  Fly   219 -PSKL--------PFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQKLLDSKDYLA 274
             ||.:        ||   :.::|:          ..|.:.|:|         |:::|||..|...
 Worm   202 SPSYINVLWSALSPF---IPEQSK----------QRIVFAGSN---------WKEELLDIVDKEC 244

  Fly   275 KDAQYG 280
            ...:||
 Worm   245 LPERYG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 32/170 (19%)
F28H7.8NP_505746.2 CRAL_TRIO_N 16..61 CDD:215024
SEC14 93..251 CDD:214706 40/198 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.