DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and T23G5.2

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001040875.1 Gene:T23G5.2 / 176302 WormBaseID:WBGene00011962 Length:719 Species:Caenorhabditis elegans


Alignment Length:231 Identity:50/231 - (21%)
Similarity:87/231 - (37%) Gaps:37/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLGSRQ--VDEALLTQLQRGIHVIPM 107
            |.|.|..| |.|||         .|.||...:...|...::..:|  ||: :|.:..|...:...
 Worm   273 KLPNDAHL-LRFLR---------ARDFDVAKAKDMVHASIIWRKQHNVDK-ILEEWTRPTVIKQY 326

  Fly   108 RP-----VSPEGPRVIISQFRNIDPK---KSNPREAFKLIFIMLELLALECDNAA---------I 155
            .|     ....|..:.|.:|..:|.|   :|...|  .|:.:.|.:.......||         |
 Worm   327 FPGCWHNSDKAGRPMYILRFGQLDTKGMLRSCGVE--NLVKLTLSICEDGLQRAAEATRKLGTPI 389

  Fly   156 SGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPS 220
            |....|||...::|..:.:.....|.|...:|:...|....::.::...:....::..::.|:..
 Worm   390 SSWSLVVDLDGLSMRHLWRPGVQCLLKIIEIVEANYPETMGQVLVVRAPRVFPVLWTLISPFIDE 454

  Fly   221 KLPFKFVVHKKS-----EDLYQHLPRDVMTIEYGGT 251
            |...||:|...|     |:|.:|:....:....||:
 Worm   455 KTRKKFMVSGGSGGDLKEELRKHIEEKFIPDFLGGS 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 34/177 (19%)
T23G5.2NP_001040875.1 PRELI 17..170 CDD:282550
CRAL_TRIO_N 256..297 CDD:215024 11/33 (33%)
SEC14 320..491 CDD:214706 33/173 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.