DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and F18A11.2

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_496771.1 Gene:F18A11.2 / 174945 WormBaseID:WBGene00008929 Length:388 Species:Caenorhabditis elegans


Alignment Length:213 Identity:36/213 - (16%)
Similarity:69/213 - (32%) Gaps:69/213 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NYYSLRSVFPE----------VLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDP 127
            |.||.::...|          |:|....|:..:...:|...:    .:|.....|::.:|..|..
 Worm    63 NSYSSKTELEEDELNKYVPIDVIGQNHQDDNKVLMFERTGKI----DISGLVDNVLMHKFMQIKL 123

  Fly   128 KKSNPREAFKLIFIMLE-----LLALECDNAAISGLIWVVDARDVTME----------------Q 171
            |             |:|     ::|.|......||.::::|...::..                .
 Worm   124 K-------------MMEGVHQKVVAAERKTGRQSGGLFIMDLDGISFSPKLISVLTGPYRIMWGT 175

  Fly   172 MMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSED-- 234
            :..:.|.||:|               |.::|.......:....:.|||.....|.|:  .||.  
 Worm   176 LFDHYPQLLQK---------------IIIVNAPSFVNVLHQACSPFLPEDYKEKIVI--TSEPAI 223

  Fly   235 --LYQHLPRDVMTIEYGG 250
              :.:|..:..:..:.||
 Worm   224 GAIQKHADKCFLPSDLGG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 29/181 (16%)
F18A11.2NP_496771.1 SEC14 72..244 CDD:214706 33/204 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.