DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and H41C03.1

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_495168.1 Gene:H41C03.1 / 173994 WormBaseID:WBGene00019268 Length:396 Species:Caenorhabditis elegans


Alignment Length:247 Identity:44/247 - (17%)
Similarity:83/247 - (33%) Gaps:82/247 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEV--------------LGSRQVDEALLT--- 96
            |:...||.|||        ..||..||.|.::...|              :|....|..||.   
 Worm    40 DKDEALAELRR--------HLRFRQYYDLDNILTNVPDHPILKKYFPLGLVGETGKDNQLLVIEC 96

  Fly    97 -------QLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLEL---LALECD 151
                   .:.:.:|:...          :|.:|:..:          |::..|.|:   ...:| 
 Worm    97 AGRIDLMGILKSVHLSDF----------LIQRFKFQE----------KMLAAMNEMERKYGTQC- 140

  Fly   152 NAAISGLIWVVDARDVTMEQMMQYDPFLL-------KKAFALVDQCIPLRFVEIHMINMRKEGQT 209
                 .:|:::|.      :.:::||.|:       :..:|.|....|.....:.:||.......
 Worm   141 -----SVIYILDL------EGLKFDPALISIVTGPYRILWASVYTAYPEWINTLFLINAPSFMTL 194

  Fly   210 IFNFVTKFLPSKLPFKFVVHKKSED----LYQHLPRDVMTIEYGGT----NG 253
            ::..:...||.:...|..:...:.|    :.:|...|.:...:|||    ||
 Worm   195 LWKAIGPLLPERTRNKVRICSGNSDWKTSVQKHAHIDNIPKHWGGTLVDKNG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 25/179 (14%)
H41C03.1NP_495168.1 SEC14 69..242 CDD:214706 30/204 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.