DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and CLVS1

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_775790.1 Gene:CLVS1 / 157807 HGNCID:23139 Length:354 Species:Homo sapiens


Alignment Length:281 Identity:64/281 - (22%)
Similarity:118/281 - (41%) Gaps:28/281 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLK-APTDEQLILAFLRRCRFSQEETKRRF 71
            |.|:....|:.|.||......:.|..::..|...|.:. ..||:..||.|||..:|.|.:..|..
Human    30 LSPETIEKARLELNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLL 94

  Fly    72 DNYYSLRSVFPEVLGSRQVDE-----ALLT----QLQRGIHVIPMRPVSPEGPRVIISQFRNIDP 127
            ..|:..|.:..::..:.:.|:     ||:.    .|:...|.         |.::::....|.|.
Human    95 AQYFQYRQLNLDMFKNFKADDPGIKRALIDGFPGVLENRDHY---------GRKILLLFAANWDQ 150

  Fly   128 KKSNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIP 192
            .:::..:..:.|.:.||:| :|.....|:|.|.::|..:.:.:|..:..|.:||.|...:....|
Human   151 SRNSFTDILRAILLSLEVL-IEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFP 214

  Fly   193 LRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKS-EDLYQHLPRDVMTIEYGGTNGYQA 256
            .||..:|.:|.......::..:..||..|...:..:|..: ..|:|.:..:.:..|:|||  ...
Human   215 ARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGT--LPP 277

  Fly   257 EAVDHWRQKLL-----DSKDY 272
            ..:..|.:.||     |..||
Human   278 YDMGTWARTLLGPDYSDENDY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 32/160 (20%)
CLVS1NP_775790.1 CRAL_TRIO_N 51..97 CDD:215024 13/45 (29%)
CRAL_TRIO 125..274 CDD:306996 32/158 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145885
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.