DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP001109

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_322055.4 Gene:AgaP_AGAP001109 / 1282054 VectorBaseID:AGAP001109 Length:709 Species:Anopheles gambiae


Alignment Length:261 Identity:56/261 - (21%)
Similarity:95/261 - (36%) Gaps:63/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IATIKTWI------TKSPHLKAPTDEQLILAFLRR--------CRFSQEETKRRFDNYYSLRSVF 81
            :..:|.:|      :..|:.||.|........|.|        ..:.|.|..|:.:..|      
Mosquito     9 LKAVKQFIDRINSSSNDPNRKAVTPAIATRFLLARKYDITRAMALYEQHELIRQREGLY------ 67

  Fly    82 PEVLGSRQVDEALLTQLQRG-IHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLEL 145
                |.....|.|.|:|:.| ..::|.|..|  |..:.:.......|.....:...:.:...|: 
Mosquito    68 ----GFDPQTEPLRTELETGKFTILPGRDAS--GAAIALFTANLHYPMTVTHKTTLQGVVYQLD- 125

  Fly   146 LALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTI 210
            :||:......:||:::.   |::..:...:|..|.:|...|:....|.|..::.:          
Mosquito   126 VALQSSETQKAGLVFIY---DMSTSKYSNFDYDLSQKILTLLKGGYPARLKKVLI---------- 177

  Fly   211 FNFVTKFLPSKLPFK----FVVHKKSEDLYQ--------HLPRDVMTIEYGGTNGYQAEAVDH-- 261
               ||..|..|.|||    ||..|..|.::.        |:||:.:.:..|||     ..|||  
Mosquito   178 ---VTAPLWFKAPFKILRLFVREKLRERVFTVSIPQLSLHVPRESLPVRLGGT-----LEVDHSS 234

  Fly   262 W 262
            |
Mosquito   235 W 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 35/168 (21%)
AgaP_AGAP001109XP_322055.4 CRAL_TRIO 83..227 CDD:279044 33/162 (20%)
PTPc 414..685 CDD:214550
PTPc 442..685 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.