DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP002065

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_320982.5 Gene:AgaP_AGAP002065 / 1281048 VectorBaseID:AGAP002065 Length:277 Species:Anopheles gambiae


Alignment Length:264 Identity:63/264 - (23%)
Similarity:124/264 - (46%) Gaps:22/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EEQAQ-RAEIIATIKTW-ITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEV 84
            ||.|: |...|||:..| :.:.|.|..|...:|||.|||..::..::.||:...:.:.|....|.
Mosquito    18 EETAELRTTSIATVTRWLLDERPDLVIPEGSRLILYFLRTTKYDLDKAKRKLMTFLNNREKLTEW 82

  Fly    85 LGSRQVDEALLTQLQRGIHV---IPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLELL 146
            ...|   :....::|..:.:   :|:........:|::.:....||:|....:.||:..::|:||
Mosquito    83 FKDR---DPFRPEIQELLDIGVFLPLHQKDALNRQVVVIRTAAHDPEKHKQDDVFKVDKMILDLL 144

  Fly   147 ALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQ--CIP--LRFVEIHM-INMRKE 206
            ....:..::.|::.:.|.:.||:...:|..|.::||:....:.  |.|  |.||.:.: :|:   
Mosquito   145 MHLDETVSVHGVVAIFDMQGVTLGHALQLTPSMIKKSVESWENYPCKPKLLEFVNVPVHVNI--- 206

  Fly   207 GQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQKLLDSKD 271
               :.|....|:.:|:..:..:.:|...|.|.:   .:.:|.||......|..:||:|.:.|:..
Mosquito   207 ---VLNVFRSFMSAKMRERVTISRKGSSLEQSI---TLPLELGGNGESYYELSEHWKQMVQDNAS 265

  Fly   272 YLAK 275
            :.||
Mosquito   266 FYAK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 33/163 (20%)
AgaP_AGAP002065XP_320982.5 SEC14 93..245 CDD:238099 33/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.