DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP012165

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_320369.4 Gene:AgaP_AGAP012165 / 1280520 VectorBaseID:AGAP012165 Length:311 Species:Anopheles gambiae


Alignment Length:310 Identity:106/310 - (34%)
Similarity:173/310 - (55%) Gaps:4/310 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLRTLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETK 68
            :||.|..:||..|..|..|:..:..|.:|.::.|:.|.||:|:.||:|.:..|||.|:.|.|..|
Mosquito     4 SLRPLSAQLAKKAADELFEKPERIDEDLAALRAWLAKCPHIKSRTDDQFLTMFLRGCKHSLERAK 68

  Fly    69 RRFDNYYSLRSVFPEVLGSRQVDE-ALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNP 132
            .:.|.||::|:..||::.:|..:| .||..::.|:.|.....|:|:|||:|:.:....||.|...
Mosquito    69 EKLDMYYTVRTALPELMRNRDPEEPKLLELIKMGVAVPLPNTVTPDGPRIILVRPGVYDPSKYTI 133

  Fly   133 REAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVE 197
            :|.|:...:|.:::..|.||..::|.:.::|..:||....:|:.|..:||...:..:..|||...
Mosquito   134 QEVFRYNTMMSDIMMKEDDNLVVAGQVGILDLANVTSAHFLQFTPTFVKKMTMMSQEGSPLRQKG 198

  Fly   198 IHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKS-EDLYQHLPRDVMTIEYGGTNGYQAEAVDH 261
            .|.||.....:|:||....|:..|...:..||..: |.||||:|:.::..||||......:...:
Mosquito   199 FHYINTPTGFETVFNMFKSFMSEKNRSRLYVHGSNLEKLYQHIPKRLLPKEYGGEGDSLKDITAN 263

  Fly   262 WRQKLLDSKDYLAKDAQYGTNEKLRVGLASAWANGELDGMSGSFRKLELD 311
            |.:|:|..::|..::.||||:|:.|||.|.  ....|.||.||||:||:|
Mosquito   264 WEKKILSYREYFLEEDQYGTDERKRVGKAK--TADSLFGMEGSFRRLEVD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 48/156 (31%)
AgaP_AGAP012165XP_320369.4 CRAL_TRIO_N 28..74 CDD:215024 18/45 (40%)
SEC14 96..253 CDD:238099 48/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29493
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.