DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP004785

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_318027.4 Gene:AgaP_AGAP004785 / 1278438 VectorBaseID:AGAP004785 Length:286 Species:Anopheles gambiae


Alignment Length:264 Identity:68/264 - (25%)
Similarity:122/264 - (46%) Gaps:14/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLGSRQV-DE 92
            |.|..|..|:|..||| ....|..|..||.....::|.|:|..:|||:||:.:.:....|.| ::
Mosquito    18 ESIEKITHWLTAQPHL-PQIQEHEIAQFLHANYGNEEATQRTIENYYTLRTNYRDCFTDRDVFND 81

  Fly    93 ALLTQLQRGIHVIPMRPVSP----EGPRVIISQFRNIDPKKSNPREAFKLIFIMLELLALECDNA 153
            |:.|.|:     |.|..:.|    ||.:::.::....|....|..:..|.:.:.|:|......||
Mosquito    82 AMQTALR-----IMMFTILPGETKEGYKMVYTRLLTSDASHFNHPQILKFMTMCLDLWVKLEGNA 141

  Fly   154 AISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFL 218
              .|.|.::|...:.:..|.:.:...:||....|...:|:|..::|.||:......:.:.|...|
Mosquito   142 --KGHIMLMDMHGMHVGHMTKMNMAAVKKHMFYVQDALPIRLKQLHFINVVPFMNWLMSLVRPLL 204

  Fly   219 PSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQKL-LDSKDYLAKDAQYGTN 282
            ..::.....:|.....|::.:|.:.:..|.|||.|...|..|.:::|| .:|:.:.|.::|...:
Mosquito   205 HKEVEEMINMHVGLGKLHEDIPIECLPNEVGGTAGSVQELHDSFKEKLYANSEWFKATESQNLVD 269

  Fly   283 EKLR 286
            |..|
Mosquito   270 ETKR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 33/159 (21%)
AgaP_AGAP004785XP_318027.4 KSR1-SAM <5..66 CDD:290277 18/48 (38%)
CRAL_TRIO 92..237 CDD:279044 29/146 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.