DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP008133

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_317327.4 Gene:AgaP_AGAP008133 / 1277823 VectorBaseID:AGAP008133 Length:262 Species:Anopheles gambiae


Alignment Length:263 Identity:64/263 - (24%)
Similarity:113/263 - (42%) Gaps:13/263 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EQAQRAEIIATIKTWI--TKSPHLKAPT---DEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFP 82
            |...|:..:..:|..|  ::...||..:   |::.:..||...:|:..|..:...||::.|....
Mosquito     4 EPTDRSRALIALKELIGASRDYALKDKSCFQDDEFLFRFLYARKFNVNEAFQLIINYHAYRQRNA 68

  Fly    83 EVLGSRQV-DEALLTQLQRGI-HVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLEL 145
            .:|....| ||.:...|:.|. .|:|.|  ...|.:|::....|.|....:....::.:.:.:|.
Mosquito    69 AILQRLSVLDETIQIALRDGFPGVLPNR--DRRGRKVLVFFTANWDYASYSLVTVYRAMLLTVEK 131

  Fly   146 LALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTI 210
            |..:..|.| :|.|.:||..:.|..|....:|.:||.....:..|.|:||..||.|......:..
Mosquito   132 LLEDKQNQA-NGFIAIVDWTNFTFRQSSNLNPKVLKLMIEGLQDCFPVRFKAIHFIGQPWYVEAA 195

  Fly   211 FNFVTKFLPSKLPFKFVVHKKS-EDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQKLLDSKDYLA 274
            ...:..||..|...:..:|..: ..|:..:.||::..|.|| .|.....: :|..:||:|...:.
Mosquito   196 LAVIRPFLKEKTRDRIKLHGSNLSTLHDCVARDILPTELGG-EGPTFNPL-NWYHELLESSQTVT 258

  Fly   275 KDA 277
            |.|
Mosquito   259 KPA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 38/157 (24%)
AgaP_AGAP008133XP_317327.4 CRAL_TRIO_N 10..60 CDD:215024 9/49 (18%)
SEC14 91..237 CDD:238099 37/149 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.