DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP006325

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_316351.4 Gene:AgaP_AGAP006325 / 1276941 VectorBaseID:AGAP006325 Length:329 Species:Anopheles gambiae


Alignment Length:327 Identity:74/327 - (22%)
Similarity:140/327 - (42%) Gaps:44/327 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANTLRTLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHL-KAPTDEQLILAFLRRCRFSQ 64
            :..||.||            .|:.:...:.:|.::.||.|.||: :..||.:.:|.|||..:.|.
Mosquito    31 IGKTLETL------------REDGSMVKQNLALLRDWIAKHPHIRRCRTDARFLLRFLRAKKHSF 83

  Fly    65 EETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKK 129
            ....:..:.|.:.|::.|.......:.:..|..|.....:..::....:|..:.:..:..:|||:
Mosquito    84 LAASQTLERYLAARTLHPSWFQRLDIRDPELADLADIGFLYALKERDADGCLMALCDWGLLDPKR 148

  Fly   130 -----SNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQ 189
                 ||...|..|.....::|| :|     :|.:.:.|.:.|.:.........:|::....|:.
Mosquito   149 YTVDHSNRMHALWLEAYGEDVLA-QC-----AGAVVIFDMQHVQLAHHSVVSLSVLRQVAHYVNN 207

  Fly   190 CIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGG---- 250
            .:|:|...:|.:|:......|.|.:..||..|:..:..:.:..::|.:.:.|.::..|:||    
Mosquito   208 AVPIRCKALHAVNVPAGALWIVNGMLGFLNEKIRNRCSLSRDYDELAEKIDRSLLPKEHGGKEPK 272

  Fly   251 TNGYQA--EAVDHWRQKLLDSKDYLAKDAQYGTNEKLRVGLASAWANGELD----GMSGSFRKLE 309
            |...:|  |..:.:|.::| :.|.:..|..:  ||...       .:..||    |..|||||||
Mosquito   273 TEHMRAFRERCERYRDRML-ALDEMEIDLDH--NEPYS-------RHAMLDDIEGGAVGSFRKLE 327

  Fly   310 LD 311
            ||
Mosquito   328 LD 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 32/164 (20%)
AgaP_AGAP006325XP_316351.4 CRAL_TRIO_N 46..93 CDD:215024 13/46 (28%)
CRAL_TRIO 126..269 CDD:279044 29/148 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.