DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP005389

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_315398.3 Gene:AgaP_AGAP005389 / 1276090 VectorBaseID:AGAP005389 Length:324 Species:Anopheles gambiae


Alignment Length:267 Identity:56/267 - (20%)
Similarity:120/267 - (44%) Gaps:6/267 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKL-AALAKSECNEEQAQRAEIIATIKTWITKSPHL-KAPTDEQLILAFLRRCRFSQEETKRRFD 72
            |:| ..:|..|..|...:|.|.:..::.||...||: :..||...:|.|||...:..:..:....
Mosquito    29 PELHRTIALQELGETDVRRVESLRLLREWIATHPHIRRCRTDALFLLRFLRARAYDVQAAQTTLV 93

  Fly    73 NYYSLRSVFPEVLGSRQVDEALLTQLQRGIH-VIPMRPVSPEGPRVIISQFRNIDPKKSNPREAF 136
            .|.::|.:|.....:....:..:.:|...:. .:|: .:...|..|.:.:.|..|..:.|.....
Mosquito    94 RYLTMRQLFRIWYENLDPSDRYMRELVENVRGCLPL-GLDRSGRMVALVKVRCYDVARFNCYHLG 157

  Fly   137 KLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMI 201
            :|..::.|....:.: ..|:|.:.::|....||...:.:....::.....:...:|:|..|:|::
Mosquito   158 RLQHMLFEAFFDDVE-LQIAGGVAIIDCDGATMGHFVCFKLSDIRNFMDCLVHALPVRVKEVHIV 221

  Fly   202 NMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQKL 266
            .:.:.||.:.|.|..|...:|..:...|...:::.:::.:|::.:|||| .....|..|..:::|
Mosquito   222 RLPRIGQALGNLVLSFAAEELRKRIFFHASMDEVLKYVDQDLLPVEYGG-KSCPEEITDSLKRRL 285

  Fly   267 LDSKDYL 273
            .|.:|.|
Mosquito   286 ADKRDTL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 29/156 (19%)
AgaP_AGAP005389XP_315398.3 CRAL_TRIO_N 49..95 CDD:215024 11/45 (24%)
CRAL_TRIO 129..271 CDD:279044 28/144 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.