DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP005387

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_315397.4 Gene:AgaP_AGAP005387 / 1276089 VectorBaseID:AGAP005387 Length:325 Species:Anopheles gambiae


Alignment Length:318 Identity:79/318 - (24%)
Similarity:135/318 - (42%) Gaps:25/318 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHL-KAPTDEQLILAFLRRCRFSQEETKRR 70
            ||......|||.|..|:...|.:.:..::.||.|.|:: |..||...:|.|||..::|.......
Mosquito    20 TLSDLYRKLAKDELREDDEIREQSLTQMREWIAKHPYIRKCRTDASFLLRFLRFRKYSVPMACEA 84

  Fly    71 FDNYYSLRSVFPEVLGSRQV-DEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPRE 134
            .:.|.::|..||:...:... |.|:...||.|  |........||..||:.:|...:..|....:
Mosquito    85 LERYLAMRETFPQWFKNLDCNDPAMREMLQDG--VFTKLGQDAEGRTVILFRFARFNVDKFTSLQ 147

  Fly   135 AFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIH 199
            ..:...:::|.| |||:...|.|...::|.....::....:....:|.....:::..|:|..|:|
Mosquito   148 EGRFTVLLIETL-LECEELQIGGFRVLIDYTGSVLKHYGIWGVSDMKVFMDAINRSYPIRIREVH 211

  Fly   200 MINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGT---NGYQAEAVDH 261
            .....|...::.|.:..|...||..:...|...|::.:.....::..|:||.   ..:.....||
Mosquito   212 GAKFPKFAVSLLNLLLTFASPKLKDRITCHNSVEEMAKRCESTLLPKEWGGVCDLQEFNQRFQDH 276

  Fly   262 W--RQKLLDSKDYLAKDAQYGTNEKLRVGLASAWAN-----GELD-GMSGSFRKLELD 311
            .  |:::|.:.|.:..|.   ||      ..|.|.:     .|:| |..||||||::|
Mosquito   277 LEDRRQVLLALDEMDIDT---TN------YTSLWKHHEAPENEIDSGAMGSFRKLDVD 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 32/155 (21%)
AgaP_AGAP005387XP_315397.4 CRAL_TRIO_N 41..88 CDD:215024 12/46 (26%)
CRAL_TRIO 115..262 CDD:279044 29/149 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.