DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP005383

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_315393.4 Gene:AgaP_AGAP005383 / 1276085 VectorBaseID:AGAP005383 Length:328 Species:Anopheles gambiae


Alignment Length:309 Identity:78/309 - (25%)
Similarity:134/309 - (43%) Gaps:24/309 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LAKSECNEEQAQRAEIIATIKTWITKSPHL-KAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLR 78
            :|..|..||.|...:.:..::.||.|:|.: ...||...:|.|||..:||........:.|...|
Mosquito    32 IAADELREEPAIVEQALEQMRDWIAKNPAIHTCRTDASFLLRFLRVRKFSHLAACETLERYLVSR 96

  Fly    79 SVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIML 143
            ..||.........|..:..:.....|:|:.. ...|..|.:.::.|:|..:....:..:...::.
Mosquito    97 QRFPAWYSKLDTAEPWVQVMIDSEFVVPLGR-DELGRVVFLVRYANLDIDRFEVTDQIRFFTMVF 160

  Fly   144 ELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQ 208
            |.:..:..| .|:||:.|.|..:|.|....|:....:|.....|.:.:|||..|:|::|:...|.
Mosquito   161 ETICHDELN-QIAGLVCVFDETNVPMRAFAQWSLTDIKNYIDCVTKALPLRVKEVHVVNLPLFGA 224

  Fly   209 TIFNFVTKFLPSKLPFKFVVHKKSED------LYQHLPRDVMTIEYGGTNGYQAEAVDHWRQKLL 267
            .:..::......||..:...::..::      |...:|::.    |||    :.||:|..|| |.
Mosquito   225 AVGEWIMSCCSEKLRSRLKCYRSMDEFAGKCNLLSLMPKEY----YGG----KQEAMDLKRQ-LR 280

  Fly   268 DSKD-----YLAKDAQYGTNEKLRVGLASAWANGELDGMSGSFRKLELD 311
            :|.|     .||.| ....:||..:.:.|....|..:||.||||||::|
Mosquito   281 ESLDRCRNIILALD-DMKVDEKRCLLVKSQTKPGGDEGMIGSFRKLDVD 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 31/161 (19%)
AgaP_AGAP005383XP_315393.4 CRAL_TRIO_N 45..92 CDD:215024 12/46 (26%)
CRAL_TRIO 121..269 CDD:279044 32/157 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.